PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000910638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 286aa    MW: 32776.9 Da    PI: 10.6646
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000910638genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT +Ed +l d+++  G g+W++ ++  g++R++k+c++rw +yl
    MDP0000910638 15 KGRWTMDEDVKLTDYIRGNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.62.5e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+  +++++  lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000910638  68 RGKFSKEEERVIINLHSVLGNK-WSKIATHLP-GRTDNEIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-21765IPR009057Homeodomain-like
PROSITE profilePS5129413.6991062IPR017930Myb domain
SuperFamilySSF466891.13E-2812109IPR009057Homeodomain-like
SMARTSM007171.7E-91464IPR001005SANT/Myb domain
PfamPF002492.0E-121562IPR001005SANT/Myb domain
CDDcd001674.68E-61762No hitNo description
PROSITE profilePS5129428.59863117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2766117IPR009057Homeodomain-like
SMARTSM007171.3E-1667115IPR001005SANT/Myb domain
PfamPF002499.4E-1668113IPR001005SANT/Myb domain
CDDcd001671.04E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MVGSPCCDEE NSLKKGRWTM DEDVKLTDYI RGNGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSKEEERVII NLHSVLGNKW SKIATHLPGR TDNEIKNYWN THLRKKLLHM  120
GIDPNTHKPR PRTDLNHLLD LSWLLRAAIV GNSNMMTSPW DNAMSLQAAA GAAQLAKMQL  180
LQRLYMMPVV SVVPPKNYNA DVKNTTTNSH FGSQPSSVWR REYEWCKPRT NHLLHFHQQQ  240
YLRGLLPQPS LTLGRNSWMM KQVNPTGKTR INLINLVIFI SGSYL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26121174108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340746.11e-170PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP02e-72MYB39_ARATH; Transcription factor MYB39
TrEMBLM5WRB46e-94M5WRB4_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s09300.12e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-72myb domain protein 9